Lineage for d3cvya1 (3cvy A:5-215)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1842687Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1842688Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 1842723Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 1842724Protein automated matches [227113] (2 species)
    not a true protein
  7. 1842725Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (6 PDB entries)
  8. 1842730Domain d3cvya1: 3cvy A:5-215 [245568]
    Other proteins in same PDB: d3cvya2
    automated match to d2wb2a1
    protein/DNA complex; complexed with fad

Details for d3cvya1

PDB Entry: 3cvy (more details), 2.7 Å

PDB Description: drosophila melanogaster (6-4) photolyase bound to repaired ds dna
PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d3cvya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvya1 c.28.1.0 (A:5-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrwrfl
qqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaavqk
lakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpeklknm
ptppkdeveqkdsaaydcptmkqlvkrpeel

SCOPe Domain Coordinates for d3cvya1:

Click to download the PDB-style file with coordinates for d3cvya1.
(The format of our PDB-style files is described here.)

Timeline for d3cvya1: