Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) automatically mapped to Pfam PF00875 |
Family c.28.1.0: automated matches [227292] (1 protein) not a true family |
Protein automated matches [227113] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (6 PDB entries) |
Domain d3cvya1: 3cvy A:5-215 [245568] Other proteins in same PDB: d3cvya2 automated match to d2wb2a1 protein/DNA complex; complexed with fad |
PDB Entry: 3cvy (more details), 2.7 Å
SCOPe Domain Sequences for d3cvya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cvya1 c.28.1.0 (A:5-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrwrfl qqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaavqk lakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpeklknm ptppkdeveqkdsaaydcptmkqlvkrpeel
Timeline for d3cvya1: