Lineage for d3cvua1 (3cvu A:5-215)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470051Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2470052Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2470089Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. 2470090Protein automated matches [227113] (4 species)
    not a true protein
  7. 2470098Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (6 PDB entries)
  8. 2470101Domain d3cvua1: 3cvu A:5-215 [245564]
    Other proteins in same PDB: d3cvua2
    automated match to d2wb2a1
    protein/DNA complex; complexed with fad

Details for d3cvua1

PDB Entry: 3cvu (more details), 2 Å

PDB Description: drosophila melanogaster (6-4) photolyase bound to ds dna with a t-t (6-4) photolesion
PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d3cvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cvua1 c.28.1.0 (A:5-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganrwrfl
qqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrdaavqk
lakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpeklknm
ptppkdeveqkdsaaydcptmkqlvkrpeel

SCOPe Domain Coordinates for d3cvua1:

Click to download the PDB-style file with coordinates for d3cvua1.
(The format of our PDB-style files is described here.)

Timeline for d3cvua1: