Lineage for d3cu7af (3cu7 A:1525-1676)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789220Superfamily b.40.3: TIMP-like [50242] (4 families) (S)
  5. 2789255Family b.40.3.3: Netrin-like domain (NTR/C345C module) [89320] (3 proteins)
    Pfam PF01759
  6. 2789259Protein Complement C5 domain [117188] (1 species)
  7. 2789260Species Human (Homo sapiens) [TaxId:9606] [117189] (2 PDB entries)
    Uniprot P01031 1530-1676 # structure of the C5a anaphylotoxin domain (679-751) is also known (47689)
  8. 2789261Domain d3cu7af: 3cu7 A:1525-1676 [245546]
    Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be
    complexed with cd, nag

Details for d3cu7af

PDB Entry: 3cu7 (more details), 3.11 Å

PDB Description: human complement component 5
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3cu7af:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu7af b.40.3.3 (A:1525-1676) Complement C5 domain {Human (Homo sapiens) [TaxId: 9606]}
ckcveadcgqmqeeldltisaetrkqtackpeiayaykvsitsitvenvfvkykatlldi
yktgeavaekdseitfikkvtctnaelvkgrqylimgkealqikynfsfryiypldsltw
ieywprdttcsscqaflanldefaediflngc

SCOPe Domain Coordinates for d3cu7af:

Click to download the PDB-style file with coordinates for d3cu7af.
(The format of our PDB-style files is described here.)

Timeline for d3cu7af: