![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily) 4 helices; irregular array, disulfide-linked |
![]() | Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) ![]() |
![]() | Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins) can be classified as disulfide-rich Pfam PF01821 |
![]() | Protein C5a anaphylotoxin [47688] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries) |
![]() | Domain d3cu7ba: 3cu7 B:679-743 [245556] Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be complexed with cd, nag |
PDB Entry: 3cu7 (more details), 3.11 Å
SCOPe Domain Sequences for d3cu7ba:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu7ba a.50.1.1 (B:679-743) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]} lqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasql ranis
Timeline for d3cu7ba: