Lineage for d3cu7aa (3cu7 A:679-743)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714706Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714707Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2714708Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2714712Protein C5a anaphylotoxin [47688] (2 species)
  7. 2714713Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 2714720Domain d3cu7aa: 3cu7 A:679-743 [245541]
    Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be
    complexed with cd, nag

Details for d3cu7aa

PDB Entry: 3cu7 (more details), 3.11 Å

PDB Description: human complement component 5
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3cu7aa:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu7aa a.50.1.1 (A:679-743) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
lqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasql
ranis

SCOPe Domain Coordinates for d3cu7aa:

Click to download the PDB-style file with coordinates for d3cu7aa.
(The format of our PDB-style files is described here.)

Timeline for d3cu7aa: