SCOPe 2.07: Domain d3azeb_: 3aze B:

Lineage for d3azeb_ (3aze B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries)

8. Domain d3azeb_: 3aze B: [245291]
   automated match to d1kx3f_
   protein/DNA complex; complexed with cl, mn; mutant

Details for d3azeb_

PDB Entry: 3aze, 3 Å

PDB Description: Crystal Structure of Human Nucleosome Core Particle Containing H3K64Q mutation

PDB Compounds: (B:) histone h4

SCOPe Domain Sequences for d3azeb_:

Sequence; same for both SEQRES and ATOM records:

>d3azeb_ a.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfg

Timeline for d3azeb_:

• d3azeb_ first appeared in SCOPe 2.04
  
• d3azeb_ appears in SCOPe 2.06
  
• d3azeb_ appears in the current release, SCOPe 2.08