SCOPe 2.06: Domain d3asno1: 3asn O:1-90

Lineage for d3asno1 (3asn O:1-90)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255751] (2 PDB entries)

8. Domain d3asno1: 3asn O:1-90 [245215]
   Other proteins in same PDB: d3asna_, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
   automated match to d3ag3b1
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asno1

PDB Entry: 3asn, 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3asno1:

Sequence; same for both SEQRES and ATOM records:

>d3asno1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d3asno1:

• d3asno1 first appeared in SCOPe 2.04
  
• d3asno1 appears in SCOPe 2.05
  
• d3asno1 appears in SCOPe 2.07
  
• d3asno1 appears in the current release, SCOPe 2.08