Lineage for d3asno1 (3asn O:1-90)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1956758Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 1956780Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 1956890Family f.17.2.0: automated matches [227239] (1 protein)
    not a true family
  6. 1956891Protein automated matches [226999] (2 species)
    not a true protein
  7. 1956892Species Cow (Bos taurus) [TaxId:9913] [255751] (1 PDB entry)
  8. 1956894Domain d3asno1: 3asn O:1-90 [245215]
    Other proteins in same PDB: d3asna_, d3asnb2, d3asnc_, d3asnd_, d3asne_, d3asnf_, d3asng_, d3asnh_, d3asni_, d3asnj_, d3asnk_, d3asnl_, d3asnm_, d3asnn_, d3asno2, d3asnp_, d3asnq_, d3asnr_, d3asns_, d3asnt_, d3asnu_, d3asnv_, d3asnw_, d3asnx_, d3asny_, d3asnz_
    automated match to d3ag3b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3asno1

PDB Entry: 3asn (more details), 3 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully oxidized state measured at 1.7470 angstrom wavelength
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3asno1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3asno1 f.17.2.0 (O:1-90) automated matches {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d3asno1:

Click to download the PDB-style file with coordinates for d3asno1.
(The format of our PDB-style files is described here.)

Timeline for d3asno1: