Class b: All beta proteins [48724] (119 folds) |
Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (24 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries) |
Domain d1fmk_1: 1fmk 82-145 [24511] Other proteins in same PDB: d1fmk_2, d1fmk_3 |
PDB Entry: 1fmk (more details), 1.5 Å
SCOP Domain Sequences for d1fmk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmk_1 b.34.2.1 (82-145) c-src protein tyrosine kinase {Human (Homo sapiens)} mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd siqa
Timeline for d1fmk_1: