Lineage for d1fmk_1 (1fmk 82-145)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227619Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 227633Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)
  8. 227634Domain d1fmk_1: 1fmk 82-145 [24511]
    Other proteins in same PDB: d1fmk_2, d1fmk_3

Details for d1fmk_1

PDB Entry: 1fmk (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src

SCOP Domain Sequences for d1fmk_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmk_1 b.34.2.1 (82-145) c-src protein tyrosine kinase {Human (Homo sapiens)}
mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
siqa

SCOP Domain Coordinates for d1fmk_1:

Click to download the PDB-style file with coordinates for d1fmk_1.
(The format of our PDB-style files is described here.)

Timeline for d1fmk_1: