SCOPe 2.04: Domain d2zdxa2: 2zdx A:188-385

Lineage for d2zdxa2 (2zdx A:188-385)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225008] (10 PDB entries)

8. Domain d2zdxa2: 2zdx A:188-385 [244909]
   Other proteins in same PDB: d2zdxa1, d2zdxb1
   automated match to d2e0ab2
   complexed with p4a

Details for d2zdxa2

PDB Entry: 2zdx, 2.54 Å

PDB Description: Inhibitor-bound structures of human pyruvate dehydrogenase kinase 4

PDB Compounds: (A:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2zdxa2:

Sequence, based on SEQRES records:

>d2zdxa2 d.122.1.0 (A:188-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal
ssesieklpvfnksafkh

Sequence, based on observed residues (ATOM records):

>d2zdxa2 d.122.1.0 (A:188-385) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh
lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf
sytfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesieklpvfnksafkh

Timeline for d2zdxa2:

• d2zdxa2 is new in SCOPe 2.04-stable
  
• d2zdxa2 appears in SCOPe 2.05
  
• d2zdxa2 appears in the current release, SCOPe 2.08