![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
![]() | Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
![]() | Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
![]() | Protein automated matches [226867] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries) |
![]() | Domain d2zdxa2: 2zdx A:188-385 [244909] Other proteins in same PDB: d2zdxa1, d2zdxb1 automated match to d2e0ab2 complexed with p4a |
PDB Entry: 2zdx (more details), 2.54 Å
SCOPe Domain Sequences for d2zdxa2:
Sequence, based on SEQRES records: (download)
>d2zdxa2 d.122.1.0 (A:188-385) automated matches {Human (Homo sapiens) [TaxId: 9606]} pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf sytystaptpvmdnsrnaplagfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkal ssesieklpvfnksafkh
>d2zdxa2 d.122.1.0 (A:188-385) automated matches {Human (Homo sapiens) [TaxId: 9606]} pshigsidpncdvvavvqdafecsrmlcdqyylsspelkltqvngkfpdqpihivyvpsh lhhmlfelfknamratvehqenqpsltpievivvlgkedltikisdrgggvplriidrlf sytfgyglpisrlyakyfqgdlnlyslsgygtdaiiylkalssesieklpvfnksafkh
Timeline for d2zdxa2: