SCOPe 2.04: Domain d2yyaa3: 2yya A:323-423

Lineage for d2yyaa3 (2yya A:323-423)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (10 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [255714] (2 PDB entries)

8. Domain d2yyaa3: 2yya A:323-423 [244884]
   Other proteins in same PDB: d2yyaa1, d2yyaa2, d2yyab1, d2yyab2
   automated match to d1gsoa1

Details for d2yyaa3

PDB Entry: 2yya, 2.4 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus

PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yyaa3:

Sequence; same for both SEQRES and ATOM records:

>d2yyaa3 b.84.2.0 (A:323-423) automated matches {Aquifex aeolicus [TaxId: 63363]}
eryaldvvlasrgypekpetgkiihgldylksmedvvvfhagtkkegnftvtsggrvlnv
caygktlkeakerayeairyvcfegmhyrkdigdkafkyls

Timeline for d2yyaa3:

• d2yyaa3 is new in SCOPe 2.04-stable
  
• d2yyaa3 appears in SCOPe 2.05
  
• d2yyaa3 appears in the current release, SCOPe 2.08