Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein GMP synthetase [52319] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [255715] (2 PDB entries) |
Domain d2ywcb1: 2ywc B:1-189 [244859] Other proteins in same PDB: d2ywca2, d2ywca3, d2ywcb2, d2ywcb3, d2ywcc2, d2ywcc3, d2ywcd2, d2ywcd3 automated match to d1gpma2 complexed with xmp |
PDB Entry: 2ywc (more details), 2.2 Å
SCOPe Domain Sequences for d2ywcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ywcb1 c.23.16.1 (B:1-189) GMP synthetase {Thermus thermophilus HB8 [TaxId: 300852]} mvlvldfgsqytrliarrlrelrafslilpgdapleevlkhrpqalilsggprsvfdpda prpdprlfssglpllgicygmqllaqelggrveragraeygkalltrhegplfrglegev qvwmshqdavtapppgwrvvaeteenpvaaiaspdgraygvqfhpevahtpkgmqilenf lelagvkrd
Timeline for d2ywcb1: