SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ywcd3 (2ywc D:383-503)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170593Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2170612Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) (S)
    automatically mapped to Pfam PF00958
  5. 2170613Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)
  6. 2170614Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)
  7. 2170620Species Thermus thermophilus HB8 [TaxId:300852] [255717] (2 PDB entries)
  8. 2170628Domain d2ywcd3: 2ywc D:383-503 [244867]
    Other proteins in same PDB: d2ywca1, d2ywca2, d2ywcb1, d2ywcb2, d2ywcc1, d2ywcc2, d2ywcd1, d2ywcd2
    automated match to d1gpma3
    complexed with xmp

Details for d2ywcd3

PDB Entry: 2ywc (more details), 2.2 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus in complex with XMP
PDB Compounds: (D:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywcd3:

Sequence, based on SEQRES records: (download)

>d2ywcd3 d.52.2.1 (D:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrsvgvagder
kygyvlalravttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiew
e

Sequence, based on observed residues (ATOM records): (download)

>d2ywcd3 d.52.2.1 (D:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrgyvlalrav
ttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiewe

SCOPe Domain Coordinates for d2ywcd3:

Click to download the PDB-style file with coordinates for d2ywcd3.
(The format of our PDB-style files is described here.)

Timeline for d2ywcd3: