Lineage for d2ywcc2 (2ywc C:190-382)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861264Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2861332Protein GMP synthetase, central domain [52404] (2 species)
  7. 2861338Species Thermus thermophilus HB8 [TaxId:300852] [255716] (2 PDB entries)
  8. 2861345Domain d2ywcc2: 2ywc C:190-382 [244863]
    Other proteins in same PDB: d2ywca1, d2ywca3, d2ywcb1, d2ywcb3, d2ywcc1, d2ywcc3, d2ywcd1, d2ywcd3
    automated match to d1gpma1
    complexed with xmp

Details for d2ywcc2

PDB Entry: 2ywc (more details), 2.2 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus in complex with XMP
PDB Compounds: (C:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywcc2:

Sequence, based on SEQRES records: (download)

>d2ywcc2 c.26.2.1 (C:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg
ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf
rflaqgtlypdviesagghgaakikshhnvgglpedlefellepfrllfkdevrelalll
glpdtlrlrhpfp

Sequence, based on observed residues (ATOM records): (download)

>d2ywcc2 c.26.2.1 (C:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg
ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf
rflaqgtlypdviefellepfrllfkdevrelalllglpdtlrlrhpfp

SCOPe Domain Coordinates for d2ywcc2:

Click to download the PDB-style file with coordinates for d2ywcc2.
(The format of our PDB-style files is described here.)

Timeline for d2ywcc2: