SCOPe 2.07: Domain d2yuua1: 2yuu A:8-77

Lineage for d2yuua1 (2yuu A:8-77)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.49.1: Cysteine-rich domain [57889] (4 families)

5. Family g.49.1.0: automated matches [254207] (1 protein)
   not a true family

6. Protein automated matches [254456] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries)

8. Domain d2yuua1: 2yuu A:8-77 [244833]
   Other proteins in same PDB: d2yuua2, d2yuua3
   automated match to d3uffa_
   complexed with zn

Details for d2yuua1

PDB Entry: 2yuu

PDB Description: solution structure of the first phorbol esters/diacylglycerol binding domain of human protein kinase c, delta

PDB Compounds: (A:) protein kinase c delta type

SCOPe Domain Sequences for d2yuua1:

Sequence; same for both SEQRES and ATOM records:

>d2yuua1 g.49.1.0 (A:8-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqakihyiknhefiatffgqptfcsvckdfvwglnkqgykcrqcnaaihkkcidkiigrc
tgtaansrdt

Timeline for d2yuua1:

• d2yuua1 first appeared in SCOPe 2.04, called d2yuua_
  
• d2yuua1 appears in SCOPe 2.06
  
• d2yuua1 appears in the current release, SCOPe 2.08