Lineage for d2yuua1 (2yuu A:8-77)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037801Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037802Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 3037854Family g.49.1.0: automated matches [254207] (1 protein)
    not a true family
  6. 3037855Protein automated matches [254456] (2 species)
    not a true protein
  7. 3037856Species Human (Homo sapiens) [TaxId:9606] [255130] (3 PDB entries)
  8. 3037859Domain d2yuua1: 2yuu A:8-77 [244833]
    Other proteins in same PDB: d2yuua2, d2yuua3
    automated match to d3uffa_
    complexed with zn

Details for d2yuua1

PDB Entry: 2yuu (more details)

PDB Description: solution structure of the first phorbol esters/diacylglycerol binding domain of human protein kinase c, delta
PDB Compounds: (A:) protein kinase c delta type

SCOPe Domain Sequences for d2yuua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yuua1 g.49.1.0 (A:8-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqakihyiknhefiatffgqptfcsvckdfvwglnkqgykcrqcnaaihkkcidkiigrc
tgtaansrdt

SCOPe Domain Coordinates for d2yuua1:

Click to download the PDB-style file with coordinates for d2yuua1.
(The format of our PDB-style files is described here.)

Timeline for d2yuua1: