| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries) |
| Domain d2yuqa1: 2yuq A:8-85 [244832] Other proteins in same PDB: d2yuqa2 automated match to d1awja_ |
PDB Entry: 2yuq (more details)
SCOPe Domain Sequences for d2yuqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yuqa1 b.34.2.1 (A:8-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ednrrplwepeetvvialydyqtndpqelalrrneeyclldsseihwwrvqdrnghegyv
pssylvekspnnletyew
Timeline for d2yuqa1: