SCOPe 2.08: Domain d2yuqa1: 2yuq A:8-85

Lineage for d2yuqa1 (2yuq A:8-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d2yuqa1: 2yuq A:8-85 [244832]
   Other proteins in same PDB: d2yuqa2
   automated match to d1awja_

Details for d2yuqa1

PDB Entry: 2yuq

PDB Description: solution structure of the sh3 domain of human tyrosine-protein kinase itk/tsk

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2yuqa1:

Sequence; same for both SEQRES and ATOM records:

>d2yuqa1 b.34.2.1 (A:8-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ednrrplwepeetvvialydyqtndpqelalrrneeyclldsseihwwrvqdrnghegyv
pssylvekspnnletyew

Timeline for d2yuqa1:

• d2yuqa1 first appeared in SCOPe 2.04, called d2yuqa_
  
• d2yuqa1 appears in SCOPe 2.07