Lineage for d2yrya1 (2yry A:8-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803934Domain d2yrya1: 2yry A:8-122 [244809]
    Other proteins in same PDB: d2yrya2
    automated match to d1xx0a1

Details for d2yrya1

PDB Entry: 2yry (more details)

PDB Description: solution structure of the ph domain of pleckstrin homology domain- containing family a member 6 from human
PDB Compounds: (A:) Pleckstrin homology domain-containing family A member 6

SCOPe Domain Sequences for d2yrya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrya1 b.55.1.0 (A:8-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkrshsmkrnpnapvtkagwlfkqassgvkqwnkrwfvlvdrclfyykdekeesilgsip
llsfrvaavqpsdnisrkhtfkaehagvrtyffsaespeeqeawiqamgeaarvq

SCOPe Domain Coordinates for d2yrya1:

Click to download the PDB-style file with coordinates for d2yrya1.
(The format of our PDB-style files is described here.)

Timeline for d2yrya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yrya2