PDB entry 2yry

View 2yry on RCSB PDB site
Description: Solution structure of the PH domain of Pleckstrin homology domain-containing family A member 6 from human
Class: signaling protein
Keywords: PH domain, PEPP-3, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-03, released 2007-10-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin homology domain-containing family A member 6
    Species: Homo sapiens [TaxId:9606]
    Gene: PLEKHA6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H5 (7-121)
      • expression tag (0-6)
    Domains in SCOPe 2.08: d2yrya1, d2yrya2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yryA (A:)
    gssgssggkrshsmkrnpnapvtkagwlfkqassgvkqwnkrwfvlvdrclfyykdekee
    silgsipllsfrvaavqpsdnisrkhtfkaehagvrtyffsaespeeqeawiqamgeaar
    vq