Lineage for d2yrwa3 (2yrw A:323-418)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560355Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1560356Protein automated matches [254496] (10 species)
    not a true protein
  7. 1560374Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries)
  8. 1560377Domain d2yrwa3: 2yrw A:323-418 [244805]
    Other proteins in same PDB: d2yrwa1, d2yrwa2
    automated match to d1gsoa1
    complexed with po4

Details for d2yrwa3

PDB Entry: 2yrw (more details), 2.2 Å

PDB Description: Crystal structure of GAR synthetase from Geobacillus kaustophilus
PDB Compounds: (A:) Phosphoribosylglycinamide synthetase

SCOPe Domain Sequences for d2yrwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yrwa3 b.84.2.0 (A:323-418) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrraie

SCOPe Domain Coordinates for d2yrwa3:

Click to download the PDB-style file with coordinates for d2yrwa3.
(The format of our PDB-style files is described here.)

Timeline for d2yrwa3: