| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (11 species) not a true protein |
| Species Geobacillus kaustophilus [TaxId:1462] [255711] (4 PDB entries) |
| Domain d2yrwa3: 2yrw A:323-418 [244805] Other proteins in same PDB: d2yrwa1, d2yrwa2 automated match to d1gsoa1 complexed with po4 |
PDB Entry: 2yrw (more details), 2.2 Å
SCOPe Domain Sequences for d2yrwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yrwa3 b.84.2.0 (A:323-418) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
deavlgvvlaakgypgayergaeirgldrispdallfhagtkreggawytnggrvlllaa
kgetlakakekayeqlaaidcdglfyrrdigrraie
Timeline for d2yrwa3: