Lineage for d2yjec1 (2yje C:6-146)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606432Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries)
  8. 1606442Domain d2yjec1: 2yje C:6-146 [244775]
    Other proteins in same PDB: d2yjea1, d2yjeb2, d2yjec2
    automated match to d1c0fa1
    complexed with atp, lab, mg

Details for d2yjec1

PDB Entry: 2yje (more details), 3.1 Å

PDB Description: oligomeric assembly of actin bound to mrtf-a
PDB Compounds: (C:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2yjec1:

Sequence, based on SEQRES records: (download)

>d2yjec1 c.55.1.0 (C:6-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe
tfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d2yjec1 c.55.1.0 (C:6-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
talvcdngsglvkagfagddapravfpsivgsyvgdeaqtlkypiehgiitnwddmekiw
hhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqavlslyasg

SCOPe Domain Coordinates for d2yjec1:

Click to download the PDB-style file with coordinates for d2yjec1.
(The format of our PDB-style files is described here.)

Timeline for d2yjec1: