![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (42 species) not a true protein |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries) |
![]() | Domain d2yjeb1: 2yje B:6-146 [244773] Other proteins in same PDB: d2yjea1, d2yjeb2, d2yjec2 automated match to d1c0fa1 complexed with atp, lab, mg |
PDB Entry: 2yje (more details), 3.1 Å
SCOPe Domain Sequences for d2yjeb1:
Sequence, based on SEQRES records: (download)
>d2yjeb1 c.55.1.0 (B:6-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} talvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil tlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfe tfnvpamyvaiqavlslyasg
>d2yjeb1 c.55.1.0 (B:6-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} talvcdngsglvkagfagddapravfpsivgsyvgdeaqskrgiltlkypiehgiitnwd dmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyvaiqavl slyasg
Timeline for d2yjeb1: