Lineage for d2xx1a1 (2xx1 A:2-159)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1775410Protein automated matches [226877] (3 species)
    not a true protein
  7. 1775413Species Achromobacter xylosoxidans [TaxId:85698] [225099] (10 PDB entries)
  8. 1775454Domain d2xx1a1: 2xx1 A:2-159 [244601]
    automated match to d1gs7a1
    complexed with cu, no2, so4; mutant

Details for d2xx1a1

PDB Entry: 2xx1 (more details), 3 Å

PDB Description: structure of the n90s mutant of nitrite reductase from alcaligenes xylosoxidans complexed with nitrite
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2xx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xx1a1 b.6.1.3 (A:2-159) automated matches {Achromobacter xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphsvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d2xx1a1:

Click to download the PDB-style file with coordinates for d2xx1a1.
(The format of our PDB-style files is described here.)

Timeline for d2xx1a1: