Lineage for d1gs7a1 (1gs7 A:1-159)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strandsSuperfamily b.6.1: Cupredoxins [49503] (8 families) 
contains copper-binding site
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) Protein Nitrite reductase, NIR [49551] (5 species)
consists of two domains of this fold
Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (23 PDB entries)
Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
Domain d1gs7a1: 1gs7 A:1-159 [65531]
complexed with cu, zn; mutant
Details for d1gs7a1
PDB Entry: 1gs7 (more details), 1.85 Å
PDB Description: crystal structure of h254f mutant of alcaligenes xylosoxidans nitrite reductase
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductaseSCOPe Domain Sequences for d1gs7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gs7a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp
SCOPe Domain Coordinates for d1gs7a1:
Click to download the PDB-style file with coordinates for d1gs7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gs7a1:
- d1gs7a1 first appeared in SCOP 1.59
- d1gs7a1 appears in SCOPe 2.04
- d1gs7a1 appears in SCOPe 2.06
- d1gs7a1 appears in the current release, SCOPe 2.08
View in 3D
