![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein C-Crk, N-terminal SH3 domain [50046] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50047] (9 PDB entries) |
![]() | Domain d1ckaa_: 1cka A: [24459] |
PDB Entry: 1cka (more details), 1.5 Å
SCOPe Domain Sequences for d1ckaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky
Timeline for d1ckaa_: