Lineage for d1ckaa_ (1cka A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13103Protein C-Crk, N-terminal SH3 domain [50046] (1 species)
  7. 13104Species Mouse (Mus musculus) [TaxId:10090] [50047] (3 PDB entries)
  8. 13105Domain d1ckaa_: 1cka A: [24459]

Details for d1ckaa_

PDB Entry: 1cka (more details), 1.5 Å

PDB Description: structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk

SCOP Domain Sequences for d1ckaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus)}
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky

SCOP Domain Coordinates for d1ckaa_:

Click to download the PDB-style file with coordinates for d1ckaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ckaa_: