Lineage for d1ckaa_ (1cka A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782943Protein C-Crk, N-terminal SH3 domain [50046] (1 species)
  7. 2782944Species Mouse (Mus musculus) [TaxId:10090] [50047] (8 PDB entries)
  8. 2782945Domain d1ckaa_: 1cka A: [24459]

Details for d1ckaa_

PDB Entry: 1cka (more details), 1.5 Å

PDB Description: structural basis for the specific interaction of lysine-containing proline-rich peptides with the n-terminal sh3 domain of c-crk
PDB Compounds: (A:) c-crk n-terminal sh3 domain

SCOPe Domain Sequences for d1ckaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]}
aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky

SCOPe Domain Coordinates for d1ckaa_:

Click to download the PDB-style file with coordinates for d1ckaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ckaa_: