Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein C-Crk, N-terminal SH3 domain [50046] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50047] (9 PDB entries) |
Domain d1ckaa_: 1cka A: [24459] |
PDB Entry: 1cka (more details), 1.5 Å
SCOP Domain Sequences for d1ckaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky
Timeline for d1ckaa_: