| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) ![]() contains similar fold but lacks its catalytic centre |
| Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
| Protein automated matches [227062] (4 species) not a true protein |
| Species Clostridium perfringens [TaxId:1502] [255689] (1 PDB entry) |
| Domain d2xpka1: 2xpk A:40-178 [244576] Other proteins in same PDB: d2xpka2, d2xpka3, d2xpkb2, d2xpkb3 automated match to d2v5ca1 complexed with z0m |
PDB Entry: 2xpk (more details), 2.4 Å
SCOPe Domain Sequences for d2xpka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xpka1 d.92.2.0 (A:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt
Timeline for d2xpka1: