Lineage for d2xpkb2 (2xpk B:179-495)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820146Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 1820197Protein automated matches [254553] (2 species)
    not a true protein
  7. 1820204Species Clostridium perfringens [TaxId:1502] [255690] (1 PDB entry)
  8. 1820206Domain d2xpkb2: 2xpk B:179-495 [244580]
    Other proteins in same PDB: d2xpka1, d2xpka3, d2xpkb1, d2xpkb3
    automated match to d2v5ca2
    complexed with z0m

Details for d2xpkb2

PDB Entry: 2xpk (more details), 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases
PDB Compounds: (B:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpkb2 c.1.8.10 (B:179-495) automated matches {Clostridium perfringens [TaxId: 1502]}
vsargivegfygtpwthqdrldqikfygenklntyiyapkddpyhrekwrepypesemqr
mqelinasaenkvdfvfgispgidirfdgdageedfnhlitkaeslydmgvrsfaiywdd
iqdksaakhaqvlnrfneefvkakgdvkplitcpteydtgamvsngqpraytrifaetvd
psievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypvtdyfkgklalgpmhgldkg
lnqyvdfftvnpmehaelskisihtaadyswnmdnydydkawnraidmlygdlaedmkvf
anhstrmdnktwaksgr

SCOPe Domain Coordinates for d2xpkb2:

Click to download the PDB-style file with coordinates for d2xpkb2.
(The format of our PDB-style files is described here.)

Timeline for d2xpkb2: