Lineage for d2xpka3 (2xpk A:496-624)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1754445Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 1754446Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 1754478Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 1754479Protein automated matches [254554] (2 species)
    not a true protein
  7. 1754486Species Clostridium perfringens [TaxId:1502] [255691] (1 PDB entry)
  8. 1754487Domain d2xpka3: 2xpk A:496-624 [244578]
    Other proteins in same PDB: d2xpka1, d2xpka2, d2xpkb1, d2xpkb2
    automated match to d2v5ca3
    complexed with z0m

Details for d2xpka3

PDB Entry: 2xpk (more details), 2.4 Å

PDB Description: cell-penetrant, nanomolar o-glcnacase inhibitors selective against lysosomal hexosaminidases
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2xpka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xpka3 a.246.1.0 (A:496-624) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d2xpka3:

Click to download the PDB-style file with coordinates for d2xpka3.
(The format of our PDB-style files is described here.)

Timeline for d2xpka3: