Lineage for d2xpca2 (2xpc A:94-297)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2137976Family c.72.2.1: MurCDEF [53624] (5 protein domains)
    automatically mapped to Pfam PF08245
  6. 2138005Protein automated matches [254549] (3 species)
    not a true protein
  7. 2138006Species Escherichia coli [TaxId:562] [255258] (8 PDB entries)
  8. 2138007Domain d2xpca2: 2xpc A:94-297 [244566]
    Other proteins in same PDB: d2xpca1, d2xpca3, d2xpca4
    automated match to d4uaga3
    complexed with 051, cl, dms, so4

Details for d2xpca2

PDB Entry: 2xpc (more details), 1.49 Å

PDB Description: second-generation sulfonamide inhibitors of murd: activity optimisation with conformationally rigid analogues of d-glutamic acid
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2xpca2:

Sequence, based on SEQRES records: (download)

>d2xpca2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d2xpca2 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirrcvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnalaala
ladaaglprasslkalttft

SCOPe Domain Coordinates for d2xpca2:

Click to download the PDB-style file with coordinates for d2xpca2.
(The format of our PDB-style files is described here.)

Timeline for d2xpca2: