PDB entry 2xpc

View 2xpc on RCSB PDB site
Description: second-generation sulfonamide inhibitors of murd: activity optimisation with conformationally rigid analogues of d-glutamic acid
Class: ligase
Keywords: ligase, cell cycle, cell division, cell shape, cell wall biogenesis/degradation, ligase synthesis
Deposited on 2010-08-26, released 2011-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: 0.17608
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylmuramoylalanine--d-glutamate ligase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8X9Y9 (0-436)
      • conflict (373)
      • expression tag (437-438)
    Domains in SCOPe 2.06: d2xpca1, d2xpca2, d2xpca3, d2xpca4
  • Heterogens: 051, DMS, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2xpcA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirgadercvsfgvnmgdyhln
    hqqgetwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglp
    hrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplaryln
    gdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfk
    nfeqrgnefarlakelgsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2xpcA (A:)
    adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
    wlmaadlivaspgialahpslsaaadagieivgdielfcreaqapivaitgsngkstvtt
    lvgemakaagvnvgvggniglpalmllddecelyvlelssfqlettsslqavaatilnvt
    edhmdrypfglqqyraaklriyenakvcvvnaddaltmpirrcvsfgvnmgdyhlnhqqg
    etwlrvkgekvlnvkemklsgqhnytnalaalaladaaglprasslkalttftglphrfe
    vvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplarylngdnv
    rlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasldqfknfeq
    rgnefarlakelgsh