Lineage for d2xhnb1 (2xhn B:1-250)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782049Family b.30.5.10: Rhamnogalacturonase B, RhgB, N-terminal domain [110151] (2 proteins)
    automatically mapped to Pfam PF09284
  6. 2782055Protein automated matches [254651] (1 species)
    not a true protein
  7. 2782056Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255685] (1 PDB entry)
  8. 2782058Domain d2xhnb1: 2xhn B:1-250 [244514]
    Other proteins in same PDB: d2xhna2, d2xhna3, d2xhnb2, d2xhnb3
    automated match to d1nkga3
    complexed with ca, edo, so4; mutant

Details for d2xhnb1

PDB Entry: 2xhn (more details), 1.52 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant
PDB Compounds: (B:) Rhamnogalacturonase B

SCOPe Domain Sequences for d2xhnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhnb1 b.30.5.10 (B:1-250) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
afgittsssayvidtnapnqlkftvsrsscditsiihygtelqyssqgshigsglgsatv
tatqsgdyikvtcvtdtltqymvvhngdpiihmatyitaepsigelrfiarlnsdllpne
epfgdvsttadgtaiegsdvflvgsetrsafysserfiddqrhciagdahrvcmilnqye
sssggpfhrdinsnnggsynalywymnsghvqtesyrmglhgpysmyfsrsgtpstsidt
sffadldikg

SCOPe Domain Coordinates for d2xhnb1:

Click to download the PDB-style file with coordinates for d2xhnb1.
(The format of our PDB-style files is described here.)

Timeline for d2xhnb1: