Lineage for d2xhna2 (2xhn A:251-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768737Family b.3.1.0: automated matches [254199] (1 protein)
    not a true family
  6. 2768738Protein automated matches [254436] (5 species)
    not a true protein
  7. 2768745Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255686] (1 PDB entry)
  8. 2768746Domain d2xhna2: 2xhn A:251-337 [244512]
    Other proteins in same PDB: d2xhna1, d2xhna3, d2xhnb1, d2xhnb3
    automated match to d1nkga1
    complexed with ca, edo, so4; mutant

Details for d2xhna2

PDB Entry: 2xhn (more details), 1.52 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant
PDB Compounds: (A:) Rhamnogalacturonase B

SCOPe Domain Sequences for d2xhna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhna2 b.3.1.0 (A:251-337) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
yvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamkpgtytmvyyq
geyavatssvtvsagstttknisgsvk

SCOPe Domain Coordinates for d2xhna2:

Click to download the PDB-style file with coordinates for d2xhna2.
(The format of our PDB-style files is described here.)

Timeline for d2xhna2: