| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255687] (1 PDB entry) |
| Domain d2xhnb3: 2xhn B:338-508 [244516] Other proteins in same PDB: d2xhna1, d2xhna2, d2xhnb1, d2xhnb2 automated match to d1nkga2 complexed with ca, edo, so4; mutant |
PDB Entry: 2xhn (more details), 1.52 Å
SCOPe Domain Sequences for d2xhnb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xhnb3 b.18.1.0 (B:338-508) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
tgttifkigewdgqptgfrnaanqlrmhpsdsrmsswgpltytvgssaltdfpmavfksv
nnpvtikftatsaqtgaatlrigttlsfaggrpqatinsytgsapaaptnldsrgvtrga
yrglgevydvsipsgtivagtntitinvisgssgdtylspnfifdcvelfq
Timeline for d2xhnb3: