Lineage for d2xhnb3 (2xhn B:338-508)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775220Species Fungus (Aspergillus aculeatus) [TaxId:5053] [255687] (1 PDB entry)
  8. 2775222Domain d2xhnb3: 2xhn B:338-508 [244516]
    Other proteins in same PDB: d2xhna1, d2xhna2, d2xhnb1, d2xhnb2
    automated match to d1nkga2
    complexed with ca, edo, so4; mutant

Details for d2xhnb3

PDB Entry: 2xhn (more details), 1.52 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a active site mutant
PDB Compounds: (B:) Rhamnogalacturonase B

SCOPe Domain Sequences for d2xhnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xhnb3 b.18.1.0 (B:338-508) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
tgttifkigewdgqptgfrnaanqlrmhpsdsrmsswgpltytvgssaltdfpmavfksv
nnpvtikftatsaqtgaatlrigttlsfaggrpqatinsytgsapaaptnldsrgvtrga
yrglgevydvsipsgtivagtntitinvisgssgdtylspnfifdcvelfq

SCOPe Domain Coordinates for d2xhnb3:

Click to download the PDB-style file with coordinates for d2xhnb3.
(The format of our PDB-style files is described here.)

Timeline for d2xhnb3: