Lineage for d2x86k_ (2x86 K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843127Species Escherichia coli [TaxId:562] [255679] (2 PDB entries)
  8. 2843148Domain d2x86k_: 2x86 K: [244463]
    automated match to d1eq2a_
    complexed with adp, bma, nap

Details for d2x86k_

PDB Entry: 2x86 (more details), 2.8 Å

PDB Description: agme bound to adp-b-mannose
PDB Compounds: (K:) ADP-l-glycero-d-manno-heptose-6-epimerase

SCOPe Domain Sequences for d2x86k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x86k_ c.2.1.2 (K:) automated matches {Escherichia coli [TaxId: 562]}
miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
ggrtsdfiesreyekplnvfgyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
eymawln

SCOPe Domain Coordinates for d2x86k_:

Click to download the PDB-style file with coordinates for d2x86k_.
(The format of our PDB-style files is described here.)

Timeline for d2x86k_: