Lineage for d2x7va_ (2x7v A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2101025Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2101337Family c.1.15.0: automated matches [191634] (1 protein)
    not a true family
  6. 2101338Protein automated matches [191168] (5 species)
    not a true protein
  7. 2101400Species Thermotoga maritima [TaxId:243274] [255680] (3 PDB entries)
  8. 2101402Domain d2x7va_: 2x7v A: [244451]
    automated match to d3aama_
    complexed with zn

Details for d2x7va_

PDB Entry: 2x7v (more details), 2.3 Å

PDB Description: Crystal structure of Thermotoga maritima endonuclease IV in the presence of zinc
PDB Compounds: (A:) Probable endonuclease 4

SCOPe Domain Sequences for d2x7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2x7va_ c.1.15.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mikigahmpiskgfdrvpqdtvniggnsfqifphnarswsaklpsdeaatkfkremkkhg
idwenafchsgylinlaspkddiwqksvellkkeveicrklgirylnihpgshlgtgeee
gidrivrglnevlnntegvvillenvsqkggnigykleqlkkirdlvdqrdrvaitydtc
hgfdsgyditkkegveallneieslfglerlkmihlndskyplgaakdrherigsgfige
egfavffsfkeiqevpwiletpggneehaedikkvfeiiekfgiev

SCOPe Domain Coordinates for d2x7va_:

Click to download the PDB-style file with coordinates for d2x7va_.
(The format of our PDB-style files is described here.)

Timeline for d2x7va_: