Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.0: automated matches [191634] (1 protein) not a true family |
Protein automated matches [191168] (3 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [255680] (3 PDB entries) |
Domain d2x7va_: 2x7v A: [244451] automated match to d3aama_ complexed with zn |
PDB Entry: 2x7v (more details), 2.3 Å
SCOPe Domain Sequences for d2x7va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2x7va_ c.1.15.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]} mikigahmpiskgfdrvpqdtvniggnsfqifphnarswsaklpsdeaatkfkremkkhg idwenafchsgylinlaspkddiwqksvellkkeveicrklgirylnihpgshlgtgeee gidrivrglnevlnntegvvillenvsqkggnigykleqlkkirdlvdqrdrvaitydtc hgfdsgyditkkegveallneieslfglerlkmihlndskyplgaakdrherigsgfige egfavffsfkeiqevpwiletpggneehaedikkvfeiiekfgiev
Timeline for d2x7va_: