SCOPe 2.08: Domain d2wzha1: 2wzh A:4-126

Lineage for d2wzha1 (2wzh A:4-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (5 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255267] (4 PDB entries)

8. Domain d2wzha1: 2wzh A:4-126 [244358]
   Other proteins in same PDB: d2wzha2, d2wzha3
   automated match to d2vvna3
   complexed with ca, gol, ngo

Details for d2wzha1

PDB Entry: 2wzh, 2.2 Å

PDB Description: btgh84 d242n in complex with meumb-derived oxazoline

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2wzha1:

Sequence, based on SEQRES records:

>d2wzha1 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Sequence, based on observed residues (ATOM records):

>d2wzha1 d.92.2.0 (A:4-126) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkys
rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

Timeline for d2wzha1:

• d2wzha1 first appeared in SCOPe 2.04
  
• d2wzha1 appears in SCOPe 2.07