Lineage for d2wzha2 (2wzh A:127-436)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083545Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 protein domains)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. 2083596Protein automated matches [254553] (2 species)
    not a true protein
  7. 2083597Species Bacteroides thetaiotaomicron [TaxId:226186] [255268] (4 PDB entries)
  8. 2083600Domain d2wzha2: 2wzh A:127-436 [244359]
    Other proteins in same PDB: d2wzha1, d2wzha3
    automated match to d2choa2
    complexed with ca, gol, ngo

Details for d2wzha2

PDB Entry: 2wzh (more details), 2.2 Å

PDB Description: btgh84 d242n in complex with meumb-derived oxazoline
PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d2wzha2:

Sequence, based on SEQRES records: (download)

>d2wzha2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

Sequence, based on observed residues (ATOM records): (download)

>d2wzha2 c.1.8.10 (A:127-436) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffndisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnylttlgdklnpsiqimwt
gdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfv
tnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgp
nghgyr

SCOPe Domain Coordinates for d2wzha2:

Click to download the PDB-style file with coordinates for d2wzha2.
(The format of our PDB-style files is described here.)

Timeline for d2wzha2: