![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
![]() | Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
![]() | Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
![]() | Protein automated matches [254554] (3 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries) |
![]() | Domain d2wzha3: 2wzh A:437-588 [244360] Other proteins in same PDB: d2wzha1, d2wzha2 automated match to d2choa1 complexed with ca, gol, ngo |
PDB Entry: 2wzh (more details), 2.2 Å
SCOPe Domain Sequences for d2wzha3:
Sequence, based on SEQRES records: (download)
>d2wzha3 a.246.1.0 (A:437-588) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt atrvikplidrtfatvvkffnqkfnahldatt
>d2wzha3 a.246.1.0 (A:437-588) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit pwvhqfkltaemgeevlkmvegnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkta trvikplidrtfatvvkffnqkfnahldatt
Timeline for d2wzha3: