SCOPe 2.08: Domain d2wp8b1: 2wp8 B:3-152

Lineage for d2wp8b1 (2wp8 B:3-152)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255013] (5 PDB entries)

8. Domain d2wp8b1: 2wp8 B:3-152 [244201]
   Other proteins in same PDB: d2wp8b2
   automated match to d2nn6b1
   complexed with cl, gol

Details for d2wp8b1

PDB Entry: 2wp8, 3 Å

PDB Description: yeast rrp44 nuclease

PDB Compounds: (B:) exosome complex component ski6

SCOPe Domain Sequences for d2wp8b1:

Sequence, based on SEQRES records:

>d2wp8b1 d.14.1.0 (B:3-152) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rleiyspeglrldgrrwnelrrfessinthphaadgssymeqgnnkiitlvkgpkeprlk
sqmdtskallnvsvninkfskfersksshknerrvleiqtslvrmfeknvmlniyprtvi
dieihvleqdggimgslingitlalidagi

Sequence, based on observed residues (ATOM records):

>d2wp8b1 d.14.1.0 (B:3-152) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rleiyspeglrldgrrwnelrrfessinthphaadgssymeqgnnkiitlvkgpkemdts
kallnvsvninerrvleiqtslvrmfeknvmlniyprtvidieihvleqdggimgsling
itlalidagi

Timeline for d2wp8b1:

• d2wp8b1 first appeared in SCOPe 2.04
  
• d2wp8b1 appears in SCOPe 2.07