SCOPe 2.08: Domain d2wp8b2: 2wp8 B:153-239

Lineage for d2wp8b2 (2wp8 B:153-239)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255655] (1 PDB entry)

8. Domain d2wp8b2: 2wp8 B:153-239 [244202]
   Other proteins in same PDB: d2wp8b1
   automated match to d2nn6b2
   complexed with cl, gol

Details for d2wp8b2

PDB Entry: 2wp8, 3 Å

PDB Description: yeast rrp44 nuclease

PDB Compounds: (B:) exosome complex component ski6

SCOPe Domain Sequences for d2wp8b2:

Sequence; same for both SEQRES and ATOM records:

>d2wp8b2 d.101.1.0 (B:153-239) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
smfdyisgisvglydttplldtnsleenamstvtlgvvgkseklslllvedkipldrlen
vlaigiagahrvrdlmdeelrkhaqkr

Timeline for d2wp8b2:

• d2wp8b2 first appeared in SCOPe 2.04
  
• d2wp8b2 appears in SCOPe 2.07