Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries) |
Domain d2wnla1: 2wnl A:1-208 [244191] Other proteins in same PDB: d2wnla2, d2wnlb2, d2wnlc2, d2wnld2, d2wnle2, d2wnlf2, d2wnlg2, d2wnlh2, d2wnli2, d2wnlj2 automated match to d2c9ta_ complexed with an4, an5, mg, nag, pg4 |
PDB Entry: 2wnl (more details), 2.7 Å
SCOPe Domain Sequences for d2wnla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnla1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d2wnla1: