SCOPe 2.06: Domain d2wnle1: 2wnl E:1-208

Lineage for d2wnle1 (2wnl E:1-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d2wnle1: 2wnl E:1-208 [244195]
   Other proteins in same PDB: d2wnla2, d2wnlb2, d2wnlc2, d2wnld2, d2wnle2, d2wnlf2, d2wnlg2, d2wnlh2, d2wnli2, d2wnlj2
   automated match to d2c9ta_
   complexed with an4, an5, mg, nag, pg4

Details for d2wnle1

PDB Entry: 2wnl, 2.7 Å

PDB Description: crystal structure of aplysia achbp in complex with anabaseine

PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2wnle1:

Sequence; same for both SEQRES and ATOM records:

>d2wnle1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d2wnle1:

• d2wnle1 first appeared in SCOPe 2.04, called d2wnle_
  
• d2wnle1 was called d2wnle_ in SCOPe 2.05
  
• d2wnle1 appears in SCOPe 2.07
  
• d2wnle1 appears in the current release, SCOPe 2.08