Lineage for d2wk5d1 (2wk5 D:34-100)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327573Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2327574Protein automated matches [254641] (5 species)
    not a true protein
  7. 2327580Species Human (Homo sapiens) [TaxId:9606] [255652] (2 PDB entries)
  8. 2327586Domain d2wk5d1: 2wk5 D:34-100 [244161]
    Other proteins in same PDB: d2wk5a2, d2wk5a3, d2wk5b2, d2wk5b3, d2wk5c2, d2wk5c3, d2wk5d2, d2wk5d3
    automated match to d1uoua1
    complexed with gol

Details for d2wk5d1

PDB Entry: 2wk5 (more details), 2.99 Å

PDB Description: structural features of native human thymidine phosphorylase and in complex with 5-iodouracil
PDB Compounds: (D:) thymidine phosphorylase

SCOPe Domain Sequences for d2wk5d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wk5d1 a.46.2.0 (D:34-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqlpelirmkrdggrlseadirgfvaavvngsaqgaqigamlmairlrgmdleetsvltq
alaqsgq

SCOPe Domain Coordinates for d2wk5d1:

Click to download the PDB-style file with coordinates for d2wk5d1.
(The format of our PDB-style files is described here.)

Timeline for d2wk5d1: