![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) ![]() |
![]() | Family d.41.3.0: automated matches [254277] (1 protein) not a true family |
![]() | Protein automated matches [254643] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255654] (2 PDB entries) |
![]() | Domain d2wk5b3: 2wk5 B:374-481 [244157] Other proteins in same PDB: d2wk5a1, d2wk5a2, d2wk5b1, d2wk5b2, d2wk5c1, d2wk5c2, d2wk5d1, d2wk5d2 automated match to d1uoua3 complexed with gol |
PDB Entry: 2wk5 (more details), 2.99 Å
SCOPe Domain Sequences for d2wk5b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wk5b3 d.41.3.0 (B:374-481) automated matches {Human (Homo sapiens) [TaxId: 9606]} rareqeellapadgtvelvralplalvlhelgagrsrageplrlgvgaellvdvgqrlrr gtpwlrvhrdgpalsgpqsralqealvlsdrapfaapspfaelvlppq
Timeline for d2wk5b3: